Lineage for d2ecba1 (2ecb A:8-83)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761140Superfamily a.4.1: Homeodomain-like [46689] (19 families) (S)
    consists only of helices
  5. 761141Family a.4.1.1: Homeodomain [46690] (40 proteins)
    Pfam PF00046
  6. 761325Protein Zinc fingers and homeoboxes protein 1, ZHX1 [158242] (1 species)
  7. 761326Species Human (Homo sapiens) [TaxId:9606] [158243] (1 PDB entry)
    Uniprot Q9UKY1 565-640
  8. 761327Domain d2ecba1: 2ecb A:8-83 [146789]

Details for d2ecba1

PDB Entry: 2ecb (more details)

PDB Description: the solution structure of the third homeobox domain of human zinc fingers and homeoboxes protein
PDB Compounds: (A:) Zinc fingers and homeoboxes protein 1

SCOP Domain Sequences for d2ecba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]}
pdftpqkfkektaeqlrvlqasflnssvltdeelnrlraqtkltrreidawftekkkska
lkeekmeidesnagss

SCOP Domain Coordinates for d2ecba1:

Click to download the PDB-style file with coordinates for d2ecba1.
(The format of our PDB-style files is described here.)

Timeline for d2ecba1: