SCOP 1.75: Domain d2ec9l2: 2ec9 L:91-140

Lineage for d2ec9l2 (2ec9 L:91-140)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57199] (5 PDB entries)

8. Domain d2ec9l2: 2ec9 L:91-140 [146787]
   Other proteins in same PDB: d2ec9h1, d2ec9l3
   automatically matched to d1pfxl2
   complexed with 24x, ca, fuc, glc

Details for d2ec9l2

PDB Entry: 2ec9, 2 Å

PDB Description: crystal structure analysis of human factor viia , souluble tissue factor complexed with bcx-3607

PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d2ec9l2:

Sequence; same for both SEQRES and ATOM records:

>d2ec9l2 g.3.11.1 (L:91-140) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d2ec9l2:

• d2ec9l2 is new in SCOP 1.75
  
• d2ec9l2 appears in SCOPe 2.01
  
• d2ec9l2 appears in the current release, SCOPe 2.08