Lineage for d2ec9l1 (2ec9 L:46-82)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 888904Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 889622Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 889623Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 889703Protein Factor IX (IXa) [57198] (2 species)
  7. 889704Species Human (Homo sapiens) [TaxId:9606] [57199] (5 PDB entries)
  8. 889707Domain d2ec9l1: 2ec9 L:46-82 [146786]
    Other proteins in same PDB: d2ec9h1, d2ec9l3
    automatically matched to d1pfxl1
    complexed with 24x, ca, fuc, glc

Details for d2ec9l1

PDB Entry: 2ec9 (more details), 2 Å

PDB Description: Crystal structure analysis of human Factor VIIa , Souluble tissue factor complexed with BCX-3607
PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d2ec9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec9l1 g.3.11.1 (L:46-82) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOP Domain Coordinates for d2ec9l1:

Click to download the PDB-style file with coordinates for d2ec9l1.
(The format of our PDB-style files is described here.)

Timeline for d2ec9l1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ec9h1