SCOPe 2.08: Domain d2ec9l1: 2ec9 L:49-86

Lineage for d2ec9l1 (2ec9 L:49-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)

8. Domain d2ec9l1: 2ec9 L:49-86 [146786]
   Other proteins in same PDB: d2ec9h_, d2ec9l2, d2ec9l3, d2ec9u_
   automated match to d2a2ql1
   complexed with 24x, aso, ca, fuc

Details for d2ec9l1

PDB Entry: 2ec9, 2 Å

PDB Description: crystal structure analysis of human factor viia , souluble tissue factor complexed with bcx-3607

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2ec9l1:

Sequence; same for both SEQRES and ATOM records:

>d2ec9l1 g.3.11.0 (L:49-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d2ec9l1:

• d2ec9l1 first appeared in SCOP 1.75
  
• d2ec9l1 appears in SCOPe 2.07