![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187233] (141 PDB entries) |
![]() | Domain d2ec9h_: 2ec9 H: [146785] Other proteins in same PDB: d2ec9l1, d2ec9l2, d2ec9l3, d2ec9u_ automated match to d1cvwh_ complexed with 24x, aso, ca, fuc |
PDB Entry: 2ec9 (more details), 2 Å
SCOPe Domain Sequences for d2ec9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ec9h_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d2ec9h_:
![]() Domains from other chains: (mouse over for more information) d2ec9l1, d2ec9l2, d2ec9l3, d2ec9u_ |