Lineage for d2ec7a_ (2ec7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036238Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 3036239Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 3036240Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 3036276Protein automated matches [254447] (3 species)
    not a true protein
  7. 3036279Species Human immunodeficiency virus type 2 (isolate ghana-1) [TaxId:11717] [255140] (1 PDB entry)
  8. 3036280Domain d2ec7a_: 2ec7 A: [146784]
    automated match to d1aafa_
    complexed with zn

Details for d2ec7a_

PDB Entry: 2ec7 (more details)

PDB Description: solution structure of human immunodificiency virus type-2 nucleocapsid protein
PDB Compounds: (A:) Gag polyprotein (Pr55Gag)

SCOPe Domain Sequences for d2ec7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec7a_ g.40.1.1 (A:) automated matches {Human immunodeficiency virus type 2 (isolate ghana-1) [TaxId: 11717]}
aqqrkvircwncgkeghsarqcraprrqgcwkcgktghvmakcperqag

SCOPe Domain Coordinates for d2ec7a_:

Click to download the PDB-style file with coordinates for d2ec7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ec7a_: