Class g: Small proteins [56992] (100 folds) |
Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) |
Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
Protein automated matches [254447] (3 species) not a true protein |
Species Human immunodeficiency virus type 2 (isolate ghana-1) [TaxId:11717] [255140] (1 PDB entry) |
Domain d2ec7a_: 2ec7 A: [146784] automated match to d1aafa_ complexed with zn |
PDB Entry: 2ec7 (more details)
SCOPe Domain Sequences for d2ec7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ec7a_ g.40.1.1 (A:) automated matches {Human immunodeficiency virus type 2 (isolate ghana-1) [TaxId: 11717]} aqqrkvircwncgkeghsarqcraprrqgcwkcgktghvmakcperqag
Timeline for d2ec7a_: