Lineage for d2ec5a2 (2ec5 A:875-1093)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631785Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
    Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;
  4. 1631786Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) (S)
    there are four conserved residues in the putative active site: two His and two Glu
  5. 1631791Family c.150.1.2: PMT domain-like [159505] (1 protein)
    This is the second from the PMT C-terminus; it retains the superfamily fold and the active site mainchain conformation but lacks the conserved in the other two families His and Glu residues
  6. 1631792Protein Dermonecrotic toxin, ToxA [159506] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 1631793Species Pasteurella multocida [TaxId:747] [159507] (3 PDB entries)
    Uniprot P17452 875-1093
  8. 1631796Domain d2ec5a2: 2ec5 A:875-1093 [146779]
    Other proteins in same PDB: d2ec5a1, d2ec5a3, d2ec5b1, d2ec5b3

Details for d2ec5a2

PDB Entry: 2ec5 (more details), 2.6 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin
PDB Compounds: (A:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ec5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec5a2 c.150.1.2 (A:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
pmpglvqylkipatvvdsdgawqflpdvassrvpievte

SCOPe Domain Coordinates for d2ec5a2:

Click to download the PDB-style file with coordinates for d2ec5a2.
(The format of our PDB-style files is described here.)

Timeline for d2ec5a2: