Lineage for d2ec0a_ (2ec0 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247714Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2247722Protein Viral RNA polymerase [56695] (18 species)
  7. 2247742Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries)
    Uniprot Q9QCE4 1858-2327
  8. 2247744Domain d2ec0a_: 2ec0 A: [146776]
    automated match to d1u09a_
    protein/RNA complex; complexed with mg, ppv

Details for d2ec0a_

PDB Entry: 2ec0 (more details), 2.75 Å

PDB Description: RNA-dependent RNA polymerase of foot-and-mouth disease virus in complex with a template-primer RNA and ATP
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d2ec0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec0a_ e.8.1.4 (A:) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

SCOPe Domain Coordinates for d2ec0a_:

Click to download the PDB-style file with coordinates for d2ec0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ec0a_: