SCOP 1.75: Domain d2ec0a1: 2ec0 A:1-470

Lineage for d2ec0a1 (2ec0 A:1-470)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)

6. Protein Viral RNA polymerase [56695] (10 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [111302] (8 PDB entries)
   Uniprot Q9QCE4 1858-2327

8. Domain d2ec0a1: 2ec0 A:1-470 [146776]
   automatically matched to d1u09a_
   complexed with mg, ppv

Details for d2ec0a1

PDB Entry: 2ec0, 2.75 Å

PDB Description: RNA-dependent RNA polymerase of foot-and-mouth disease virus in complex with a template-primer RNA and ATP

PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOP Domain Sequences for d2ec0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ec0a1 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d2ec0a1:

• d2ec0a1 is new in SCOP 1.75
  
• d2ec0a1 is called d2ec0a_ in SCOPe 2.01
  
• d2ec0a1 appears in the current release, SCOPe 2.08, called d2ec0a_