SCOPe 2.07: Domain d2ebsb1: 2ebs B:3-430

Lineage for d2ebsb1 (2ebs B:3-430)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 proteins)
   contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)

6. Protein automated matches [254516] (1 species)
   not a true protein

7. Species Geotrichum sp. [TaxId:203496] [255136] (1 PDB entry)

8. Domain d2ebsb1: 2ebs B:3-430 [146774]
   automated match to d2ebsb1
   mutant

Details for d2ebsb1

PDB Entry: 2ebs, 2.4 Å

PDB Description: crystal structure anaalysis of oligoxyloglucan reducing-end-specific cellobiohydrolase (oxg-rcbh) d465n mutant complexed with a xyloglucan heptasaccharide

PDB Compounds: (B:) Oligoxyloglucan reducing end-specific cellobiohydrolase

SCOPe Domain Sequences for d2ebsb1:

Sequence; same for both SEQRES and ATOM records:

>d2ebsb1 b.69.13.1 (B:3-430) automated matches {Geotrichum sp. [TaxId: 203496]}
hyefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmn
imgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnn
gerlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperng
tiyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpn
flyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsv
datnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaaryk
dgtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatd
tlsrvekd

Timeline for d2ebsb1:

• d2ebsb1 first appeared in SCOP 1.75
  
• d2ebsb1 appears in SCOPe 2.06
  
• d2ebsb1 appears in the current release, SCOPe 2.08