Lineage for d2ebsa2 (2ebs A:431-786)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066474Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2066475Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (2 protein domains)
    contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)
  6. 2066482Protein automated matches [254516] (1 species)
    not a true protein
  7. 2066483Species Geotrichum sp. [TaxId:203496] [255136] (1 PDB entry)
  8. 2066485Domain d2ebsa2: 2ebs A:431-786 [146773]
    automated match to d1sqja2
    mutant

Details for d2ebsa2

PDB Entry: 2ebs (more details), 2.4 Å

PDB Description: crystal structure anaalysis of oligoxyloglucan reducing-end-specific cellobiohydrolase (oxg-rcbh) d465n mutant complexed with a xyloglucan heptasaccharide
PDB Compounds: (A:) Oligoxyloglucan reducing end-specific cellobiohydrolase

SCOPe Domain Sequences for d2ebsa2:

Sequence, based on SEQRES records: (download)

>d2ebsa2 b.69.13.1 (A:431-786) automated matches {Geotrichum sp. [TaxId: 203496]}
wapswylqidgieenailslrspksgaallsgignisgmkhddltkpqkmfgapqfsnld
sidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstia
vdasgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdg
gkffvstdggksyaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrv
gtanatlvsvgapksksdgkkasapsavfiwgtdkpgsdiglyrsddngstwtrvndqeh
nysgptmieadpkvygrvylgtngrgivyadltnkksneekstakcangqkgthcy

Sequence, based on observed residues (ATOM records): (download)

>d2ebsa2 b.69.13.1 (A:431-786) automated matches {Geotrichum sp. [TaxId: 203496]}
wapswylqidgieenailslrspksgaallsgignisgmkhddltkpqkmfgapqfsnld
sidaagnfpnvvvragssgheydsacargayatdggdawtifptcppgmnashyqgstia
vdasgsqivwstkldeqasgpwyshdygktwsvpagdlkaqtanvlsdkvqdgtfyatdg
gkffvstdggksyaakgaglvtgtslmpavnpwvagdvwvpvpegglfhstdfgasftrv
gtanatlvsvgapkapsavfiwgtdkpgsdiglyrsddngstwtrvndqehnysgptmie
adpkvygrvylgtngrgivyadltneekstakcangqkgthcy

SCOPe Domain Coordinates for d2ebsa2:

Click to download the PDB-style file with coordinates for d2ebsa2.
(The format of our PDB-style files is described here.)

Timeline for d2ebsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebsa1