SCOPe 2.03: Domain d2ebsa1: 2ebs A:4-430

Lineage for d2ebsa1 (2ebs A:4-430)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.1: Oligoxyloglucan reducing end-specific cellobiohydrolase [110297] (1 protein)
   contains at least 9 BNR/Asp-box repeats (Pfam PF02012) usually associated with the 6-bladed propeller Neuraminidases (50939)

6. Protein Oligoxyloglucan reducing end-specific cellobiohydrolase [110298] (1 species)

7. Species Yeast (Geotrichum sp. M128) [TaxId:203496] [110299] (2 PDB entries)
   Uniprot Q8J0D2

8. Domain d2ebsa1: 2ebs A:4-430 [146772]
   automatically matched to d1sqja1
   mutant

Details for d2ebsa1

PDB Entry: 2ebs, 2.4 Å

PDB Description: crystal structure anaalysis of oligoxyloglucan reducing-end-specific cellobiohydrolase (oxg-rcbh) d465n mutant complexed with a xyloglucan heptasaccharide

PDB Compounds: (A:) Oligoxyloglucan reducing end-specific cellobiohydrolase

SCOPe Domain Sequences for d2ebsa1:

Sequence; same for both SEQRES and ATOM records:

>d2ebsa1 b.69.13.1 (A:4-430) Oligoxyloglucan reducing end-specific cellobiohydrolase {Yeast (Geotrichum sp. M128) [TaxId: 203496]}
yefknvaiggggyitgivahpktkdllyartdiggayrwdagtskwiplndfieaqdmni
mgtesialdpnnpdrlylaqgryvgdewaafyvsedrgqsftiyespfpmgandmgrnng
erlavnpfnsnevwmgtrtegiwkssdraktwtnvtsipdaftngigytsvifdperngt
iyasatapqgmyvthdggvswepvagqpsswlnrttgafpdkkpasiapqpmkvaltpnf
lyvtyadypgpwgvtfgevwrqnrtsgawdditprvgnsspapynnqtfpaggfcglsvd
atnpnrlvvitldrdpgpaldsiylstdagatwkdvtqlsspsnlegnwghptnaarykd
gtpvpwldfnngpqwggygaphgtpgltkfgwwmsavlidpfnpehlmygtgatiwatdt
lsrvekd

Timeline for d2ebsa1:

• d2ebsa1 first appeared in SCOP 1.75
  
• d2ebsa1 appears in SCOPe 2.02
  
• d2ebsa1 appears in SCOPe 2.04
  
• d2ebsa1 appears in the current release, SCOPe 2.08