Lineage for d2ebfx3 (2ebf X:1094-1285)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851268Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 851269Superfamily d.3.1: Cysteine proteinases [54001] (22 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 851794Family d.3.1.17: PMT C-terminal domain like [159843] (1 protein)
    displays a minimal thiol-protease fold and its catalytic triad; potential redox regulation: the catalytic cysteine can form a disulfide bond with an N-terminal cysteine
  6. 851795Protein Dermonecrotic toxin, ToxA [159844] (1 species)
    Synonym: Mitogenic toxin PMT
  7. 851796Species Pasteurella multocida [TaxId:747] [159845] (3 PDB entries)
    Uniprot P17452 1094-1285
  8. 851797Domain d2ebfx3: 2ebf X:1094-1285 [146768]
    Other proteins in same PDB: d2ebfx1, d2ebfx2
    complexed with 2po, tre

Details for d2ebfx3

PDB Entry: 2ebf (more details), 1.9 Å

PDB Description: Crystal structures reveal a thiol-protease like catalytic triad in the C-terminal region of Pasteurella multocida toxin
PDB Compounds: (X:) Dermonecrotic toxin

SCOP Domain Sequences for d2ebfx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebfx3 d.3.1.17 (X:1094-1285) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
lenwqvltppqgkilglkqfkltagfpteqsrlpllensvsedlreelmqkidaikndvk
mnslvcmeagscdsvspkvaarlkdmgleagmgasitwwrreggmefshqmhttasfkfa
gkefavdashlqfvhdqldttililpvddwaleiaqrnrainpfveyvsktgnmlalfmp
plftkprltral

SCOP Domain Coordinates for d2ebfx3:

Click to download the PDB-style file with coordinates for d2ebfx3.
(The format of our PDB-style files is described here.)

Timeline for d2ebfx3: