SCOPe 2.05: Domain d2ebfx2: 2ebf X:875-1093

Lineage for d2ebfx2 (2ebf X:875-1093)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.150: EreA/ChaN-like [159500] (1 superfamily)
   Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423;

4. Superfamily c.150.1: EreA/ChaN-like [159501] (3 families)
   there are four conserved residues in the putative active site: two His and two Glu

5. Family c.150.1.2: PMT domain-like [159505] (1 protein)
   This is the second from the PMT C-terminus; it retains the superfamily fold and the active site mainchain conformation but lacks the conserved in the other two families His and Glu residues

6. Protein Dermonecrotic toxin, ToxA [159506] (1 species)
   Synonym: Mitogenic toxin PMT

7. Species Pasteurella multocida [TaxId:747] [159507] (3 PDB entries)
   Uniprot P17452 875-1093

8. Domain d2ebfx2: 2ebf X:875-1093 [146767]
   Other proteins in same PDB: d2ebfx1, d2ebfx3
   complexed with 2po, tre

Details for d2ebfx2

PDB Entry: 2ebf, 1.9 Å

PDB Description: crystal structures reveal a thiol-protease like catalytic triad in the c-terminal region of pasteurella multocida toxin

PDB Compounds: (X:) Dermonecrotic toxin

SCOPe Domain Sequences for d2ebfx2:

Sequence; same for both SEQRES and ATOM records:

>d2ebfx2 c.150.1.2 (X:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]}
fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn
glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni
kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr
pmpglvqylkipatvvdsdgawqflpdvassrvpievte

Timeline for d2ebfx2:

• d2ebfx2 first appeared in SCOP 1.75
  
• d2ebfx2 appears in SCOPe 2.04
  
• d2ebfx2 appears in SCOPe 2.06
  
• d2ebfx2 appears in the current release, SCOPe 2.08