Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.150: EreA/ChaN-like [159500] (1 superfamily) Core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order:51423; |
Superfamily c.150.1: EreA/ChaN-like [159501] (3 families) there are four conserved residues in the putative active site: two His and two Glu |
Family c.150.1.2: PMT domain-like [159505] (1 protein) This is the second from the PMT C-terminus; it retains the superfamily fold and the active site mainchain conformation but lacks the conserved in the other two families His and Glu residues |
Protein Dermonecrotic toxin, ToxA [159506] (1 species) Synonym: Mitogenic toxin PMT |
Species Pasteurella multocida [TaxId:747] [159507] (3 PDB entries) Uniprot P17452 875-1093 |
Domain d2ebfx2: 2ebf X:875-1093 [146767] Other proteins in same PDB: d2ebfx1, d2ebfx3 complexed with 2po, tre |
PDB Entry: 2ebf (more details), 1.9 Å
SCOPe Domain Sequences for d2ebfx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebfx2 c.150.1.2 (X:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]} fdytpwdaiygdinydeqfaamsineriekcmntyrgvafqnssksidfflnnlttfidn glteiaisdlpydivqqeisqflqgsnewktldamlfnldkgdingafrkllqsakdnni kfraighsdnsvppfnnpykslyykgniiaeaiekldregqkfvvfadssllnstpgtgr pmpglvqylkipatvvdsdgawqflpdvassrvpievte
Timeline for d2ebfx2: