Lineage for d2ebca2 (2ebc A:9-60,A:182-354)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830709Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 830731Species Homo sapiens [TaxId:9606] [159560] (3 PDB entries)
  8. 830734Domain d2ebca2: 2ebc A:9-60,A:182-354 [146765]
    Other proteins in same PDB: d2ebca1
    automatically matched to d1agra2
    complexed with gdp; mutant

Details for d2ebca2

PDB Entry: 2ebc (more details), 2.24 Å

PDB Description: Mechanism underlying the critical contribution of a switch II residue in a heterotrimeric G-protein alpha subunit during C. elegans asymmetric cell division
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOP Domain Sequences for d2ebca2:

Sequence, based on SEQRES records: (download)

>d2ebca2 c.37.1.8 (A:9-60,A:182-354) Transducin (alpha subunit) {Homo sapiens [TaxId: 9606]}
dkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiveth
ftfkdlhfkmfdvdgqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmk
lfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfe
dlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records): (download)

>d2ebca2 c.37.1.8 (A:9-60,A:182-354) Transducin (alpha subunit) {Homo sapiens [TaxId: 9606]}
dkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgiveth
ftfkdlhfkmfdvdgqrseihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfds
icnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnk
rkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

SCOP Domain Coordinates for d2ebca2:

Click to download the PDB-style file with coordinates for d2ebca2.
(The format of our PDB-style files is described here.)

Timeline for d2ebca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ebca1