SCOPe 2.01: Domain d2ebca1: 2ebc A:61-181

Lineage for d2ebca1 (2ebc A:61-181)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (3 PDB entries)

8. Domain d2ebca1: 2ebc A:61-181 [146764]
   Other proteins in same PDB: d2ebca2
   automatically matched to d1agra1
   complexed with gdp

Details for d2ebca1

PDB Entry: 2ebc, 2.24 Å

PDB Description: Mechanism underlying the critical contribution of a switch II residue in a heterotrimeric G-protein alpha subunit during C. elegans asymmetric cell division

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2ebca1:

Sequence; same for both SEQRES and ATOM records:

>d2ebca1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d2ebca1:

• d2ebca1 first appeared in SCOP 1.75
  
• d2ebca1 does not appear in SCOPe 2.02