SCOPe 2.08: Domain d2ea4a2: 2ea4 A:110-374,A:449-478

Lineage for d2ea4a2 (2ea4 A:110-374,A:449-478)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Methionine aminopeptidase [55924] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55927] (18 PDB entries)
   Uniprot P50579 110-478
   methionine aminopeptidase 2 contains insert domain with a circularly permuted "winged helix" fold

8. Domain d2ea4a2: 2ea4 A:110-374,A:449-478 [146760]
   Other proteins in same PDB: d2ea4a1
   automated match to d1r58a2
   complexed with f79, mn

Details for d2ea4a2

PDB Entry: 2ea4, 2.35 Å

PDB Description: h-MetAP2 complexed with A797859

PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d2ea4a2:

Sequence; same for both SEQRES and ATOM records:

>d2ea4a2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]}
kvqtdppsvpicdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndf
reaaeahrqvrkyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnnca
ahytpnagdttvlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgik
cagidvrlcdvgeaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikg
geatrmeegevyaietfgstgkgvvXdikgsytaqfehtillrptckevvsrgddy

Timeline for d2ea4a2:

• d2ea4a2 first appeared in SCOP 1.75
  
• d2ea4a2 appears in SCOPe 2.07