Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries) Uniprot Q9QCE4 1858-2327 |
Domain d2e9za2: 2e9z A:1-470 [146753] Other proteins in same PDB: d2e9za3 automated match to d3nmaa_ protein/RNA complex; complexed with mg, ppv, utp |
PDB Entry: 2e9z (more details), 3 Å
SCOPe Domain Sequences for d2e9za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9za2 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]} glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda
Timeline for d2e9za2: