SCOPe 2.07: Domain d2e9xf2: 2e9x F:1-61

Lineage for d2e9xf2 (2e9x F:1-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)

4. Superfamily d.344.1: PriA/YqbF domain [160059] (5 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.0: automated matches [254227] (1 protein)
   not a true family

6. Protein automated matches [254515] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries)

8. Domain d2e9xf2: 2e9x F:1-61 [146748]
   Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xc1, d2e9xc2, d2e9xc3, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2
   automated match to d2e9xf2
   protein/DNA complex; complexed with so4

Details for d2e9xf2

PDB Entry: 2e9x, 2.3 Å

PDB Description: the crystal structure of human gins core complex

PDB Compounds: (F:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2e9xf2:

Sequence; same for both SEQRES and ATOM records:

>d2e9xf2 d.344.1.0 (F:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

Timeline for d2e9xf2:

• d2e9xf2 first appeared in SCOP 1.75
  
• d2e9xf2 appears in SCOPe 2.06
  
• d2e9xf2 appears in the current release, SCOPe 2.08