Lineage for d2e9xe1 (2e9x E:1-144)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781244Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 781245Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 781246Family a.278.1.1: PSF1 N-terminal domain-like [158574] (1 protein)
  6. 781247Protein DNA replication complex GINS protein PSF1 [158575] (1 species)
  7. 781248Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries)
    Uniprot Q14691 1-144! Uniprot Q14691 1-145
  8. 781250Domain d2e9xe1: 2e9x E:1-144 [146746]
    Other proteins in same PDB: d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2
    automatically matched to 2E9X A:1-144
    complexed with so4

Details for d2e9xe1

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (E:) DNA replication complex GINS protein PSF1

SCOP Domain Sequences for d2e9xe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9xe1 a.278.1.1 (E:1-144) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]}
mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip
tikfrhcsllrnrrctvaylydrllriralrweygsvlpnalrfhmaaeemewfnnykrs
latymrslggdeglditqdmkppk

SCOP Domain Coordinates for d2e9xe1:

Click to download the PDB-style file with coordinates for d2e9xe1.
(The format of our PDB-style files is described here.)

Timeline for d2e9xe1: