Lineage for d2e9xd1 (2e9x D:21-165)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781244Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 781245Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 781274Family a.278.1.4: SLD5 N-terminal domain-like [158583] (1 protein)
    N-terminal part of Pfam PF05916
  6. 781275Protein GINS complex subunit 4, SLD5 [158584] (1 species)
  7. 781276Species Human (Homo sapiens) [TaxId:9606] [158585] (3 PDB entries)
    Uniprot Q9BRT9 21-165
  8. 781277Domain d2e9xd1: 2e9x D:21-165 [146744]
    Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xc2, d2e9xd2, d2e9xe1, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xg2, d2e9xh2
    complexed with so4

Details for d2e9xd1

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (D:) GINS complex subunit 4

SCOP Domain Sequences for d2e9xd1:

Sequence, based on SEQRES records: (download)

>d2e9xd1 a.278.1.4 (D:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
lknvalkhmppnlqkvdlfravpkp

Sequence, based on observed residues (ATOM records): (download)

>d2e9xd1 a.278.1.4 (D:21-165) GINS complex subunit 4, SLD5 {Human (Homo sapiens) [TaxId: 9606]}
ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenedlkvsihqmemerir
yvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknval
khmppnlqkvdlfravpkp

SCOP Domain Coordinates for d2e9xd1:

Click to download the PDB-style file with coordinates for d2e9xd1.
(The format of our PDB-style files is described here.)

Timeline for d2e9xd1: