Lineage for d2e9xc2 (2e9x C:1001-1087)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882762Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243))
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243))
  4. 882763Superfamily d.344.1: PriA/YqbF domain [160059] (4 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 882788Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
    N-terminal part of Pfam PF06425
  6. 882789Protein GINS complex subunit 3, PSF3 [160072] (1 species)
  7. 882790Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
    Uniprot Q9BRX5 1-87
  8. 882791Domain d2e9xc2: 2e9x C:1001-1087 [146743]
    Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc1, d2e9xd1, d2e9xd2, d2e9xe1, d2e9xf1, d2e9xf2, d2e9xg1, d2e9xh1, d2e9xh2
    complexed with so4

Details for d2e9xc2

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (C:) GINS complex subunit 3

SCOP Domain Sequences for d2e9xc2:

Sequence, based on SEQRES records: (download)

>d2e9xc2 d.344.1.4 (C:1001-1087) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnav
pqgsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records): (download)

>d2e9xc2 d.344.1.4 (C:1001-1087) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffdnavpqgsklelp
lwlakglfdnkrrilsve

SCOP Domain Coordinates for d2e9xc2:

Click to download the PDB-style file with coordinates for d2e9xc2.
(The format of our PDB-style files is described here.)

Timeline for d2e9xc2: