Lineage for d2e9xc1 (2e9x C:1088-1192)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781244Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 781245Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 781264Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein)
    C-terminal part of Pfam PF06425
  6. 781265Protein GINS complex subunit 3, PSF3 [158581] (1 species)
  7. 781266Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries)
    Uniprot Q9BRX5 88-92
  8. 781267Domain d2e9xc1: 2e9x C:1088-1192 [146742]
    Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xb2, d2e9xc2, d2e9xd1, d2e9xd2, d2e9xe1, d2e9xf1, d2e9xf2, d2e9xg2, d2e9xh1, d2e9xh2
    complexed with so4

Details for d2e9xc1

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (C:) GINS complex subunit 3

SCOP Domain Sequences for d2e9xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9xc1 a.278.1.3 (C:1088-1192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr
rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg

SCOP Domain Coordinates for d2e9xc1:

Click to download the PDB-style file with coordinates for d2e9xc1.
(The format of our PDB-style files is described here.)

Timeline for d2e9xc1: