Lineage for d2e9xb2 (2e9x B:1-61)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617076Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 2617077Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 2617106Family d.344.1.0: automated matches [254227] (1 protein)
    not a true family
  6. 2617107Protein automated matches [254515] (1 species)
    not a true protein
  7. 2617108Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries)
  8. 2617111Domain d2e9xb2: 2e9x B:1-61 [146741]
    Other proteins in same PDB: d2e9xa1, d2e9xb1, d2e9xc1, d2e9xc2, d2e9xc3, d2e9xd1, d2e9xd2, d2e9xe_, d2e9xf1, d2e9xg1, d2e9xg2, d2e9xh1, d2e9xh2
    automated match to d2e9xb2
    protein/DNA complex; complexed with so4

Details for d2e9xb2

PDB Entry: 2e9x (more details), 2.3 Å

PDB Description: the crystal structure of human gins core complex
PDB Compounds: (B:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2e9xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9xb2 d.344.1.0 (B:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

SCOPe Domain Coordinates for d2e9xb2:

Click to download the PDB-style file with coordinates for d2e9xb2.
(The format of our PDB-style files is described here.)

Timeline for d2e9xb2: