Lineage for d2e9wc1 (2e9w C:2-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705702Protein Stem cell factor, SCF [47299] (1 species)
    forms dimer similar to the M-CSF and Flt3 ligand dimers
  7. 2705703Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries)
  8. 2705712Domain d2e9wc1: 2e9w C:2-140 [146738]
    automatically matched to d1exzb_
    complexed with nag

Details for d2e9wc1

PDB Entry: 2e9w (more details), 3.5 Å

PDB Description: crystal structure of the extracellular domain of kit in complex with stem cell factor (scf)
PDB Compounds: (C:) Kit ligand

SCOPe Domain Sequences for d2e9wc1:

Sequence, based on SEQRES records: (download)

>d2e9wc1 a.26.1.2 (C:2-140) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
gicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlld
kfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnr
sidafkdfvvasetsdcvv

Sequence, based on observed residues (ATOM records): (download)

>d2e9wc1 a.26.1.2 (C:2-140) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]}
gicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlld
kfsniseglsnysiidklvnivddlvecvkenssksfkspeprlftpeeffrifnrsida
fkdfvvtsdcvv

SCOPe Domain Coordinates for d2e9wc1:

Click to download the PDB-style file with coordinates for d2e9wc1.
(The format of our PDB-style files is described here.)

Timeline for d2e9wc1: