![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Stem cell factor, SCF [47299] (1 species) forms dimer similar to the M-CSF and Flt3 ligand dimers |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47300] (3 PDB entries) |
![]() | Domain d2e9wc1: 2e9w C:2-140 [146738] automatically matched to d1exzb_ complexed with nag |
PDB Entry: 2e9w (more details), 3.5 Å
SCOPe Domain Sequences for d2e9wc1:
Sequence, based on SEQRES records: (download)
>d2e9wc1 a.26.1.2 (C:2-140) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]} gicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlld kfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnr sidafkdfvvasetsdcvv
>d2e9wc1 a.26.1.2 (C:2-140) Stem cell factor, SCF {Human (Homo sapiens) [TaxId: 9606]} gicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlld kfsniseglsnysiidklvnivddlvecvkenssksfkspeprlftpeeffrifnrsida fkdfvvtsdcvv
Timeline for d2e9wc1: