Lineage for d2e9ta2 (2e9t A:1-470)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623030Protein Viral RNA polymerase [56695] (17 species)
  7. 2623050Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries)
    Uniprot Q9QCE4 1858-2327
  8. 2623055Domain d2e9ta2: 2e9t A:1-470 [146733]
    Other proteins in same PDB: d2e9ta3, d2e9td3
    automated match to d1u09a_
    protein/RNA complex; complexed with mg, ppv

Details for d2e9ta2

PDB Entry: 2e9t (more details), 2.6 Å

PDB Description: Foot-and-mouth disease virus RNA-polymerase RNA dependent in complex with a template-primer RNA and 5F-UTP
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d2e9ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9ta2 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

SCOPe Domain Coordinates for d2e9ta2:

Click to download the PDB-style file with coordinates for d2e9ta2.
(The format of our PDB-style files is described here.)

Timeline for d2e9ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e9ta3