SCOPe 2.08: Domain d2e9rx2: 2e9r X:1-470

Lineage for d2e9rx2 (2e9r X:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Foot-and-mouth disease virus [TaxId:12110] [111302] (7 PDB entries)
   Uniprot Q9QCE4 1858-2327

8. Domain d2e9rx2: 2e9r X:1-470 [146732]
   Other proteins in same PDB: d2e9rx3
   automated match to d1u09a_
   protein/RNA complex; complexed with mg, rtp
   missing some secondary structures that made up less than one-third of the common domain

Details for d2e9rx2

PDB Entry: 2e9r, 2.81 Å

PDB Description: Foot-and-mouth disease virus RNA-dependent RNA polymerase in complex with a template-primer RNA and with ribavirin

PDB Compounds: (X:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d2e9rx2:

Sequence; same for both SEQRES and ATOM records:

>d2e9rx2 e.8.1.4 (X:1-470) Viral RNA polymerase {Foot-and-mouth disease virus [TaxId: 12110]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d2e9rx2:

• d2e9rx2 first appeared in SCOP 1.75, called d2e9rx1
  
• d2e9rx2 appears in SCOPe 2.07