SCOPe 2.02: Domain d2e9pa_: 2e9p A:

Lineage for d2e9pa_ (2e9p A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (293 PDB entries)

8. Domain d2e9pa_: 2e9p A: [146731]
   automated match to d1ia8a_
   complexed with 77a

Details for d2e9pa_

PDB Entry: 2e9p, 2.6 Å

PDB Description: Structure of h-CHK1 complexed with A771129

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2e9pa_:

Sequence; same for both SEQRES and ATOM records:

>d2e9pa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplk

Timeline for d2e9pa_:

• d2e9pa_ first appeared in SCOP 1.75, called d2e9pa1
  
• d2e9pa_ appears in SCOPe 2.01
  
• d2e9pa_ appears in SCOPe 2.03
  
• d2e9pa_ appears in the current release, SCOPe 2.08