Lineage for d2e9oa_ (2e9o A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931656Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)
  8. 1931949Domain d2e9oa_: 2e9o A: [146730]
    automated match to d1ia8a_
    complexed with a58

Details for d2e9oa_

PDB Entry: 2e9o (more details), 2.1 Å

PDB Description: Structure of h-CHK1 complexed with AA582939
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d2e9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9oa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplk

SCOPe Domain Coordinates for d2e9oa_:

Click to download the PDB-style file with coordinates for d2e9oa_.
(The format of our PDB-style files is described here.)

Timeline for d2e9oa_: