| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries) |
| Domain d2e8aa2: 2e8a A:188-382 [146725] automated match to d3iucc2 complexed with anp, mg |
PDB Entry: 2e8a (more details), 1.77 Å
SCOPe Domain Sequences for d2e8aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e8aa2 c.55.1.0 (A:188-382) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgkgernvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvnhfveefkr
khkkdisqnkravrrlrtacerakrtlssstqasleidslfegidfytsitrarfeelcs
dlfrstlepvekalrdakldkaqihdlvlvggstripkvqkllqdffngrdlnksinpde
avaygaavqaailmg
Timeline for d2e8aa2: