SCOPe 2.08: Domain d2e89d2: 2e89 D:217-313

Lineage for d2e89d2 (2e89 D:217-313)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
   beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432

4. Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family)

5. Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)

6. Protein TilS-like protein Aq_1887 [143132] (1 species)
   lacks the C-terminal domain of the E. coli homologue

7. Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
   Uniprot O67728 217-311

8. Domain d2e89d2: 2e89 D:217-313 [146723]
   Other proteins in same PDB: d2e89a1, d2e89b1, d2e89c1, d2e89d1
   automated match to d1wy5a2
   complexed with atp, lys, mg

Details for d2e89d2

PDB Entry: 2e89, 2.5 Å

PDB Description: Crystal structure of Aquifex aeolicus TilS in a complex with ATP, Magnesium ion, and L-lysine

PDB Compounds: (D:) tRNA(Ile)-lysidine synthase

SCOPe Domain Sequences for d2e89d2:

Sequence; same for both SEQRES and ATOM records:

>d2e89d2 d.229.1.1 (D:217-313) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwlcf

Timeline for d2e89d2:

• d2e89d2 first appeared in SCOP 1.75
  
• d2e89d2 appears in SCOPe 2.07