Lineage for d2e89d1 (2e89 D:1-216)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 827433Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 827807Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 828016Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)
  6. 828017Protein TilS-like protein Aq_1887 [142087] (1 species)
  7. 828018Species Aquifex aeolicus [TaxId:63363] [142088] (3 PDB entries)
    Uniprot O67728 1-216
  8. 828024Domain d2e89d1: 2e89 D:1-216 [146722]
    Other proteins in same PDB: d2e89a2, d2e89b2, d2e89c2, d2e89d2
    automatically matched to d1wy5a1
    complexed with atp, lys, mg

Details for d2e89d1

PDB Entry: 2e89 (more details), 2.5 Å

PDB Description: Crystal structure of Aquifex aeolicus TilS in a complex with ATP, Magnesium ion, and L-lysine
PDB Compounds: (D:) tRNA(Ile)-lysidine synthase

SCOP Domain Sequences for d2e89d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e89d1 c.26.2.5 (D:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
akfkglrwvedetnyevsiprnrirhrvipelkrin

SCOP Domain Coordinates for d2e89d1:

Click to download the PDB-style file with coordinates for d2e89d1.
(The format of our PDB-style files is described here.)

Timeline for d2e89d1: