Lineage for d2e89a2 (2e89 A:217-311)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880991Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
    beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432
  4. 880992Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) (S)
  5. 880993Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)
  6. 880994Protein TilS-like protein Aq_1887 [143132] (1 species)
    lacks the C-terminal domain of the E. coli homologue
  7. 880995Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
    Uniprot O67728 217-311
  8. 880998Domain d2e89a2: 2e89 A:217-311 [146717]
    Other proteins in same PDB: d2e89a1, d2e89b1, d2e89c1, d2e89d1
    automatically matched to d1wy5a2
    complexed with atp, lys, mg

Details for d2e89a2

PDB Entry: 2e89 (more details), 2.5 Å

PDB Description: Crystal structure of Aquifex aeolicus TilS in a complex with ATP, Magnesium ion, and L-lysine
PDB Compounds: (A:) tRNA(Ile)-lysidine synthase

SCOP Domain Sequences for d2e89a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e89a2 d.229.1.1 (A:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

SCOP Domain Coordinates for d2e89a2:

Click to download the PDB-style file with coordinates for d2e89a2.
(The format of our PDB-style files is described here.)

Timeline for d2e89a2: