Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries) Uniprot P38501 |
Domain d2e86c2: 2e86 C:167-337 [146713] automatically matched to d1ndra2 complexed with act, azi, cu, cu1, trs |
PDB Entry: 2e86 (more details), 1.5 Å
SCOP Domain Sequences for d2e86c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e86c2 b.6.1.3 (C:167-337) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap
Timeline for d2e86c2:
View in 3D Domains from other chains: (mouse over for more information) d2e86a1, d2e86a2, d2e86b1, d2e86b2 |