Lineage for d2e86b1 (2e86 B:4-161)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2381987Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. 2381990Domain d2e86b1: 2e86 B:4-161 [146710]
    automated match to d3h4fa1
    complexed with act, azi, cu, cu1, trs

Details for d2e86b1

PDB Entry: 2e86 (more details), 1.5 Å

PDB Description: Azide bound to copper containing nitrite reductase from A. faecalis S-6
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2e86b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e86b1 b.6.1.0 (B:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg

SCOPe Domain Coordinates for d2e86b1:

Click to download the PDB-style file with coordinates for d2e86b1.
(The format of our PDB-style files is described here.)

Timeline for d2e86b1: