Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (31 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
Domain d2e86a2: 2e86 A:162-339 [146709] automated match to d3h4fa2 complexed with act, azi, cu, cu1, trs |
PDB Entry: 2e86 (more details), 1.5 Å
SCOPe Domain Sequences for d2e86a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e86a2 b.6.1.0 (A:162-339) automated matches {Alcaligenes faecalis [TaxId: 511]} lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d2e86a2:
View in 3D Domains from other chains: (mouse over for more information) d2e86b1, d2e86b2, d2e86c1, d2e86c2 |