Lineage for d2e7ia1 (2e7i A:8-371)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132207Family c.67.1.9: SepSecS-like [159704] (2 protein domains)
    Pfam PF05889
  6. 2132208Protein Selenocysteinyl-tRNA synthase (SepSecS) [159705] (3 species)
  7. 2132209Species Archaeoglobus fulgidus [TaxId:2234] [159707] (2 PDB entries)
    Uniprot O30207 8-371
  8. 2132212Domain d2e7ia1: 2e7i A:8-371 [146702]
    complexed with plp, so4

Details for d2e7ia1

PDB Entry: 2e7i (more details), 3 Å

PDB Description: Crystal Structure of Sep-tRNA:Cys-tRNA Synthase from Archaeoglobus fulgidus
PDB Compounds: (A:) Sep-tRNA:Cys-tRNA synthase

SCOPe Domain Sequences for d2e7ia1:

Sequence, based on SEQRES records: (download)

>d2e7ia1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]}
dfinidplqtggklteearqallewgdgysvcdfcttgrldeiktppihdfihnqlpkfl
gcdvarvtngareakfavmhslakkdawvvmdenchyssyvaaeraglnialvpktdypd
yaitpenfaqtieetkkrgevvlalitypdgnygnlpdvkkiakvcseydvpllvngaya
igrmpvslkeigadfivgsghksmaasgpigvmgmkeewaeivlrrsekyknkevellgc
targatiitlmasfphvrerikrwdeevekarrfaaemeklgikqlgdnphnhdlmffha
evlyeiskkakggrfflyrelksrkihgikpgltryfklstyglsdeevdyvlnafkeii
ekys

Sequence, based on observed residues (ATOM records): (download)

>d2e7ia1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]}
dfinidplqtggklteearqallewppihdfihnqlpkflgcdvarvtngareakfavmh
slakkdawvvmdenchyssyvaaeraglnialvpktdypdyaitpenfaqtieetkkrge
vvlalitypdgnygnlpdvkkiakvcseydvpllvngayaigrmpvslkeigadfivgsg
hksmaasgpigvmgmkeewaeivlrrsekyknkevellgctargatiitlmasfphvrer
ikrwdeevekarrfaaemeklgikqlgdnphnhdlmffhaevlyeiskkakggrfflyre
lksrkihgikpgltryfklstyglsdeevdyvlnafkeiiekys

SCOPe Domain Coordinates for d2e7ia1:

Click to download the PDB-style file with coordinates for d2e7ia1.
(The format of our PDB-style files is described here.)

Timeline for d2e7ia1: