Lineage for d2e53b_ (2e53 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778821Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 2778825Domain d2e53b_: 2e53 B: [146694]
    automated match to d1wbfa_
    complexed with ca, mn

Details for d2e53b_

PDB Entry: 2e53 (more details), 2.4 Å

PDB Description: crystal structure of basic winged bean lectin in complex with b blood group disaccharide
PDB Compounds: (B:) Basic agglutinin

SCOPe Domain Sequences for d2e53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e53b_ b.29.1.1 (B:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2e53b_:

Click to download the PDB-style file with coordinates for d2e53b_.
(The format of our PDB-style files is described here.)

Timeline for d2e53b_: