![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (4 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (14 PDB entries) |
![]() | Domain d2e51b1: 2e51 B:1-236 [146690] automatically matched to d1wbfa_ complexed with a2g, bma, ca, fuc, gla, mn, nag |
PDB Entry: 2e51 (more details), 2.5 Å
SCOP Domain Sequences for d2e51b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e51b1 b.29.1.1 (B:1-236) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslp
Timeline for d2e51b1: