Lineage for d2e50a1 (2e50 A:1-222)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616242Fold d.305: NAP-like [143112] (1 superfamily)
    core: central meander 4-stranded beta-sheet (order: 1234) transversed by a C-terminal helix
  4. 2616243Superfamily d.305.1: NAP-like [143113] (2 families) (S)
  5. 2616244Family d.305.1.1: NAP-like [143114] (2 proteins)
    Pfam PF00956
  6. 2616250Protein Protein SET [160140] (1 species)
    Phosphatase 2A inhibitor I2PP2A
  7. 2616251Species Human (Homo sapiens) [TaxId:9606] [160141] (2 PDB entries)
    Uniprot Q01105 1-235
  8. 2616253Domain d2e50a1: 2e50 A:1-222 [146687]
    complexed with tre

Details for d2e50a1

PDB Entry: 2e50 (more details), 2.3 Å

PDB Description: crystal structure of set/taf-1beta/inhat
PDB Compounds: (A:) Protein SET

SCOPe Domain Sequences for d2e50a1:

Sequence, based on SEQRES records: (download)

>d2e50a1 d.305.1.1 (A:1-222) Protein SET {Human (Homo sapiens) [TaxId: 9606]}
msaqaakvskkelnsnhdgadetsekeqqeaiehidevqneidrlneqaseeilkveqky
nklrqpffqkrseliakipnfwvttfvnhpqvsallgeedeeamhyltrvevtefediks
gyridfyfdenpyfenkvlskefhmnesgdpssksteikwksgkdmtkrssqtqnkasrk
rqheepesfftwftdhsdagadelgevikddiwpnplqyylv

Sequence, based on observed residues (ATOM records): (download)

>d2e50a1 d.305.1.1 (A:1-222) Protein SET {Human (Homo sapiens) [TaxId: 9606]}
msaqaakvskkelnsdetsekeqqeaiehidevqneidrlneqaseeilkveqkynklrq
pffqkrseliakipnfwvttfvnhpqvsallgeedeeamhyltrvevtefediksgyrid
fyfdenpyfenkvlskefhssksteikwksgkdmfftwftadelgevikddiwpnplqyy
lv

SCOPe Domain Coordinates for d2e50a1:

Click to download the PDB-style file with coordinates for d2e50a1.
(The format of our PDB-style files is described here.)

Timeline for d2e50a1: