Lineage for d2e4ha_ (2e4h A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055409Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2055410Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2055414Protein CLIP-115 [141230] (1 species)
  7. 2055415Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 2055418Domain d2e4ha_: 2e4h A: [146686]
    automated match to d1lpla_

Details for d2e4ha_

PDB Entry: 2e4h (more details)

PDB Description: solution structure of cytoskeletal protein in complex with tubulin tail
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2e4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4ha_ b.34.10.1 (A:) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
relkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpky
glfapvhkvtkigf

SCOPe Domain Coordinates for d2e4ha_:

Click to download the PDB-style file with coordinates for d2e4ha_.
(The format of our PDB-style files is described here.)

Timeline for d2e4ha_: