Lineage for d2e4ha1 (2e4h A:212-282)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797091Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 797092Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 797096Protein CLIP-115 [141230] (1 species)
  7. 797097Species Human (Homo sapiens) [TaxId:9606] [141231] (4 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 797099Domain d2e4ha1: 2e4h A:212-282 [146686]
    automatically matched to d2cp3a1

Details for d2e4ha1

PDB Entry: 2e4h (more details)

PDB Description: solution structure of cytoskeletal protein in complex with tubulin tail
PDB Compounds: (A:) Restin

SCOP Domain Sequences for d2e4ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
lkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpkygl
fapvhkvtkig

SCOP Domain Coordinates for d2e4ha1:

Click to download the PDB-style file with coordinates for d2e4ha1.
(The format of our PDB-style files is described here.)

Timeline for d2e4ha1: