Lineage for d2e43a_ (2e43 A:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644061Superfamily h.1.3: Leucine zipper domain [57959] (2 families) (S)
  5. 2644062Family h.1.3.1: Leucine zipper domain [57960] (17 proteins)
  6. 2644093Protein C/ebp beta [57985] (2 species)
  7. 2644094Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 2644097Domain d2e43a_: 2e43 A: [146684]
    automated match to d1h88b_
    protein/DNA complex; mutant

Details for d2e43a_

PDB Entry: 2e43 (more details), 2.1 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
PDB Compounds: (A:) CCAAT/enhancer-binding protein beta

SCOPe Domain Sequences for d2e43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e43a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl
fk

SCOPe Domain Coordinates for d2e43a_:

Click to download the PDB-style file with coordinates for d2e43a_.
(The format of our PDB-style files is described here.)

Timeline for d2e43a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2e43b_