Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.3: Leucine zipper domain [57959] (1 family) |
Family h.1.3.1: Leucine zipper domain [57960] (16 proteins) |
Protein C/ebp beta [57985] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries) |
Domain d2e43a_: 2e43 A: [146684] automated match to d1h88b_ protein/DNA complex; mutant |
PDB Entry: 2e43 (more details), 2.1 Å
SCOPe Domain Sequences for d2e43a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e43a_ h.1.3.1 (A:) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]} sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl fk
Timeline for d2e43a_: