Lineage for d2e43a1 (2e43 A:271-332)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1246835Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1247023Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1247024Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1247055Protein C/ebp beta [57985] (2 species)
  7. 1247056Species Human (Homo sapiens) [TaxId:9606] [64590] (10 PDB entries)
  8. 1247062Domain d2e43a1: 2e43 A:271-332 [146684]
    automatically matched to d1h88b_
    protein/DNA complex; mutant

Details for d2e43a1

PDB Entry: 2e43 (more details), 2.1 Å

PDB Description: crystal structure of c/ebpbeta bzip homodimer k269a mutant bound to a high affinity dna fragment
PDB Compounds: (A:) CCAAT/enhancer-binding protein beta

SCOPe Domain Sequences for d2e43a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e43a1 h.1.3.1 (A:271-332) C/ebp beta {Human (Homo sapiens) [TaxId: 9606]}
sdeykirrernniavrksrdkakmrnletqhkvleltaenerlqkkveqlsrelstlrnl
fk

SCOPe Domain Coordinates for d2e43a1:

Click to download the PDB-style file with coordinates for d2e43a1.
(The format of our PDB-style files is described here.)

Timeline for d2e43a1: