Lineage for d2e3ha1 (2e3h A:212-282)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784903Protein CLIP-115 [141230] (1 species)
  7. 2784904Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 2784905Domain d2e3ha1: 2e3h A:212-282 [146676]
    automatically matched to d2cp3a1

Details for d2e3ha1

PDB Entry: 2e3h (more details), 1.45 Å

PDB Description: Crystal structure of the CLIP-170 CAP-Gly domain 2
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2e3ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
lkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpkygl
fapvhkvtkig

SCOPe Domain Coordinates for d2e3ha1:

Click to download the PDB-style file with coordinates for d2e3ha1.
(The format of our PDB-style files is described here.)

Timeline for d2e3ha1: