Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein CLIP-115 [141230] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries) Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149 |
Domain d2e3ha1: 2e3h A:212-282 [146676] automatically matched to d2cp3a1 |
PDB Entry: 2e3h (more details), 1.45 Å
SCOPe Domain Sequences for d2e3ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} lkigdrvlvggtkagvvrflgetdfakgewcgveldeplgkndgavagtryfqcqpkygl fapvhkvtkig
Timeline for d2e3ha1: