SCOPe 2.08: Domain d2e35a2: 2e35 A:2-68

Lineage for d2e35a2 (2e35 A:2-68)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d2e35a2: 2e35 A:2-68 [146673]
   Other proteins in same PDB: d2e35a1
   automatically matched to 2HGJ L:2-68

Details for d2e35a2

PDB Entry: 2e35

PDB Description: the minimized average structure of l11 with rg refinement

PDB Compounds: (A:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2e35a2:

Sequence; same for both SEQRES and ATOM records:

>d2e35a2 d.47.1.1 (A:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

Timeline for d2e35a2:

• d2e35a2 first appeared in SCOP 1.75
  
• d2e35a2 appears in SCOPe 2.07