SCOPe 2.08: Domain d2e21c1: 2e21 C:1-216

Lineage for d2e21c1 (2e21 C:1-216)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.5: PP-loop ATPase [82359] (2 proteins)
   automatically mapped to Pfam PF01171

6. Protein TilS-like protein Aq_1887 [142087] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [142088] (3 PDB entries)
   Uniprot O67728 1-216

8. Domain d2e21c1: 2e21 C:1-216 [146639]
   Other proteins in same PDB: d2e21a2, d2e21b2, d2e21c2, d2e21d2
   automated match to d1wy5a1
   complexed with anp

Details for d2e21c1

PDB Entry: 2e21, 2.7 Å

PDB Description: Crystal structure of TilS in a complex with AMPPNP from Aquifex aeolicus.

PDB Compounds: (C:) tRNA(Ile)-lysidine synthase

SCOPe Domain Sequences for d2e21c1:

Sequence; same for both SEQRES and ATOM records:

>d2e21c1 c.26.2.5 (C:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
mnpesrvirkvlalqndekifsgerrvliafsggvdsvvltdvllklknyfslkevalah
fnhmlresaerdeefckefakernmkifvgkedvrafakenrmsleeagrflrykflkei
lesegfdciatahhlndlletsllfftrgtgldgligflpkeevirrplyyvkrseieey
akfkglrwvedetnyevsiprnrirhrvipelkrin

Timeline for d2e21c1:

• d2e21c1 first appeared in SCOP 1.75
  
• d2e21c1 appears in SCOPe 2.07