![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily) beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432 |
![]() | Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family) ![]() |
![]() | Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins) |
![]() | Protein TilS-like protein Aq_1887 [143132] (1 species) lacks the C-terminal domain of the E. coli homologue |
![]() | Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries) Uniprot O67728 217-311 |
![]() | Domain d2e21b2: 2e21 B:217-314 [146638] Other proteins in same PDB: d2e21a1, d2e21b1, d2e21c1, d2e21d1 automated match to d1wy5a2 complexed with anp |
PDB Entry: 2e21 (more details), 2.7 Å
SCOPe Domain Sequences for d2e21b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e21b2 d.229.1.1 (B:217-314) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig ekdyekvelvrsllekggevnlgkgkvlkrkerwlcfs
Timeline for d2e21b2: