SCOP 1.75: Domain d2e21a2: 2e21 A:217-311

Lineage for d2e21a2 (2e21 A:217-311)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.229: MesJ substrate recognition domain-like [82828] (1 superfamily)
   beta-alpha(2)-beta(3); 2 layers: a/b; antiparallel beta-sheet, order:1432

4. Superfamily d.229.1: MesJ substrate recognition domain-like [82829] (1 family)

5. Family d.229.1.1: MesJ substrate recognition domain-like [82830] (2 proteins)

6. Protein TilS-like protein Aq_1887 [143132] (1 species)
   lacks the C-terminal domain of the E. coli homologue

7. Species Aquifex aeolicus [TaxId:63363] [143133] (3 PDB entries)
   Uniprot O67728 217-311

8. Domain d2e21a2: 2e21 A:217-311 [146636]
   Other proteins in same PDB: d2e21a1, d2e21b1, d2e21c1, d2e21d1
   automatically matched to d1wy5a2
   complexed with anp

Details for d2e21a2

PDB Entry: 2e21, 2.7 Å

PDB Description: Crystal structure of TilS in a complex with AMPPNP from Aquifex aeolicus.

PDB Compounds: (A:) tRNA(Ile)-lysidine synthase

SCOP Domain Sequences for d2e21a2:

Sequence; same for both SEQRES and ATOM records:

>d2e21a2 d.229.1.1 (A:217-311) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}
enledtflkmvkvlraerefleeeaqklykevkkgncldvkklkekplalqrrvirkfig
ekdyekvelvrsllekggevnlgkgkvlkrkerwl

Timeline for d2e21a2:

• d2e21a2 is new in SCOP 1.75
  
• d2e21a2 appears in SCOPe 2.01
  
• d2e21a2 appears in the current release, SCOPe 2.08